The domain within your query sequence starts at position 255 and ends at position 310; the E-value for the A_amylase_inhib domain shown below is 43553.57800.

SAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNAC

A_amylase_inhib

Alpha amylase inhibitor
A_amylase_inhib
SMART accession number:SM00783
Description: Alpha amylase inhibitor inhibits mammalian alpha-amylases specifically, by forming a tight stoichiometric 1:1 complex with alpha-amylase. The inhibitor has no action on plant and microbial alpha amylases.
Interpro abstract (IPR000833):

Alpha-amylase inhibitor inhibits mammalian alpha-amylases specifically, by forming a tight stoichiometric 1:1 complex with alpha-amylase. The inhibitor has no action on plant and microbial alpha amylases.

A crystal structure has been determined for tendamistat, the 74-amino acid inhibitor produced by Streptomyces tendae that targets a wide range of mammalian alpha-amylases [ (PUBMED:14501112) ]. The binding of tendamistat to alpha-amylase leads to the steric blockage of the active site of the enzyme. The crystal structure of tendamistat revealed an immunoglobulin-like fold that could potentially adopt multiple conformations. Such molecular flexibility could enable an induced-fit type of binding that would both optimise binding and allow broad target specificity.

GO function:alpha-amylase inhibitor activity (GO:0015066)
Family alignment:
View or

There are 98 A_amylase_inhib domains in 98 proteins in SMART's nrdb database.

Click on the following links for more information.