The domain within your query sequence starts at position 84 and ends at position 322; the E-value for the Fibrillarin domain shown below is 3.1e-177.

AKVVIEPHRHAGVYIARGKEDLLVTKNMAPGESVYGEKRISVEEPSKEDGVPPTKVEYRV
WNPFRSKLAAGIMGGLDELFIAPGKKVLYLGAASGTSVSHVSDVVGPEGVVYAVEFSHRP
GRELISMAKKRPNIIPIIEDARHPQKYRMLIGMVDCVFADVAQPDQARIIALNSHMFLKD
QGGVVISIKANCIDSTVDAETVFAREVQKLREERIKPLEQLTLEPYERDHCIVVGRYMR

Fibrillarin

 Fibrillarin
PFAM accession number:PF01269
Interpro abstract (IPR000692):

Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [ (PUBMED:2026646) (PUBMED:8493104) ]. It is associated with U3, U8 and U13 small nuclear RNAs in mammals [ (PUBMED:2026646) ] and is similar to the yeast NOP1 protein [ (PUBMED:2686980) ]. Fibrillarin has a well conserved sequence of around 320 amino acids, and contains 3 domains, an N-terminal Gly/Arg-rich region; a central domain resembling other RNA-binding proteins and containing an RNP-2-like consensus sequence; and a C-terminal alpha-helical domain. An evolutionarily related pre-rRNA processing protein, which lacks the Gly/Arg-rich domain, has been found in various archaebacteria.

GO process:rRNA processing (GO:0006364)
GO function:RNA binding (GO:0003723), methyltransferase activity (GO:0008168)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fibrillarin