The domain within your query sequence starts at position 42 and ends at position 136; the E-value for the SH2 domain shown below is 2350.46545.

VGSFMGYLRIFNPHPVKTGGGPQAEDLLLEVHLRDPVLQVEVGKFVSGSEMLHLAVLHSR
KLCVYSVSGTLGNVEHGNQYQIKLMYEHHLQRTAC

SH2

Src homology 2 domains
SH2
SMART accession number:SM00252
Description: Src homology 2 domains bind phosphotyrosine-containing polypeptides via 2 surface pockets. Specificity is provided via interaction with residues that are distinct from the phosphotyrosine. Only a single occurrence of a SH2 domain has been found in S. cerevisiae.
Interpro abstract (IPR000980):

The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps (PUBMED:3025655). Similar sequences were later found in many other intracellular signal-transducing proteins (PUBMED:1377638). SH2 domains function as regulatory modules of intracellular signalling cascades by interacting with high affinity to phosphotyrosine-containing target peptides in a sequence-specific, SH2 domains recognize between 3-6 residues C-terminal to the phosphorylated tyrosine in a fashion that differs from one SH2 domain to another, and strictly phosphorylation-dependent manner (PUBMED:7883800), (PUBMED:15335710), (PUBMED:14731533), (PUBMED:7531822). They are found in a wide variety of protein contexts e.g., in association with catalytic domains of phospholipase Cy (PLCy) and the non-receptor protein tyrosine kinases; within structural proteins such as fodrin and tensin; and in a group of small adaptor molecules, i.e Crk and Nck. The domains are frequently found as repeats in a single protein sequence and will then often bind both mono- and di-phosphorylated substrates.

The structure of the SH2 domain belongs to the alpha+beta class, its overall shape forming a compact flattened hemisphere. The core structural elements comprise a central hydrophobic anti-parallel beta-sheet, flanked by 2 short alpha-helices. The loop between strands 2 and 3 provides many of the binding interactions with the phosphate group of its phosphopeptide ligand, and is hence designated the phosphate binding loop, the phosphorylated ligand binds perpendicular to the beta-sheet and typically interacts with the phosphate binding loop and a hydrophobic binding pocket that interacts with a pY+3 side chain. The N- and C-termini of the domain are close together in space and on the opposite face from the phosphopeptide binding surface and it has been speculated that this has facilitated their integration into surface-exposed regions of host proteins (PUBMED:11911873).

GO function:protein binding (GO:0005515)
Family alignment:
View or

There are 4250 SH2 domains in 3867 proteins in SMART's nrdb database.

Click on the following links for more information.